PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang0394s00050.1
Common NameLR48_Vigan10g230400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB
Protein Properties Length: 219aa    MW: 24200.3 Da    PI: 6.0019
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang0394s00050.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding27.66.6e-095332048
                      TTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding 20 GggtWktIartmgkgRtlkqcksrwqkyl 48
                      G g+W+ Iar  g+ R++k+c++rw +yl
  Vang0394s00050.1  5 GQGCWSDIARNAGLQRCGKSCRLRWINYL 33
                      7789***********************97 PP

2Myb_DNA-binding53.84.5e-173983147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                      rg+++++E+el+++++ +lG++ W+ Ia++++ gRt++++k++w++ 
  Vang0394s00050.1 39 RGAFSPQEEELIIHLHSLLGNR-WSQIAARLP-GRTDNEIKNFWNST 83
                      89********************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.458133IPR017930Myb domain
SMARTSM0071780235IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-15440IPR009057Homeodomain-like
PfamPF002499.6E-7533IPR001005SANT/Myb domain
CDDcd001679.78E-5533No hitNo description
SuperFamilySSF466892.26E-211992IPR009057Homeodomain-like
PROSITE profilePS5129426.3463488IPR017930Myb domain
SMARTSM007171.7E-163886IPR001005SANT/Myb domain
PfamPF002497.3E-163983IPR001005SANT/Myb domain
CDDcd001677.54E-134184No hitNo description
Gene3DG3DSA:1.10.10.609.1E-274188IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 219 aa     Download sequence    Send to blast
MITKGQGCWS DIARNAGLQR CGKSCRLRWI NYLRPDLKRG AFSPQEEELI IHLHSLLGNR  60
WSQIAARLPG RTDNEIKNFW NSTLKKRLKM SSSNINNTSS PNNSDSSDPR DVMGGIMPMN  120
DQHDLMTMCM DSSSSTSSSS MQSMQANMAL TDQFDPFPLL SNRYDMTTGA AGFLDNMAAC  180
LNQVGMVDHD DGVVHGGYGA LEPNKMGLES DFSLPPLES
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-2258826108B-MYB
1h8a_C1e-2258846128MYB TRANSFORMING PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18389LKKRLKM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150440.0AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014506438.11e-130PREDICTED: transcription factor MYB3-like
TrEMBLA0A0S3T8821e-162A0A0S3T882_PHAAN; Uncharacterized protein
TrEMBLA0A0L9VND51e-162A0A0L9VND5_PHAAN; Uncharacterized protein
STRINGGLYMA13G07020.21e-114(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77434128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12870.19e-48myb domain protein 46
Publications ? help Back to Top
  1. Yang K, et al.
    Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8
    [PMID:26460024]